missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COX6A1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92889-0.1ml
This item is not returnable.
View return policy
Description
COX6A1 Polyclonal antibody specifically detects COX6A1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| COX6A1 | |
| Polyclonal | |
| Western Blot 1:200-1:2000, Immunohistochemistry 1:20-1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| COX VIa-L, COX6A, COX6AL, Cytochrome c oxidase polypeptide VIa-liver, cytochrome c oxidase subunit 6A1, mitochondrial, cytochrome C oxidase subunit VIa homolog, cytochrome c oxidase subunit VIa polypeptide 1, Cytochrome c oxidase subunit VIA-liver, MGC104500 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 25-109 of human COX6A1 (NP_004364.2). SSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE | |
| 0.1 mL | |
| Endocrinology, Neurodegeneration, Neuroscience | |
| 1337 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction