COX16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18434302	Novus Biologicals NBP2-31863-25ul	25 μL
18136052	Novus Biologicals NBP2-31863	0.1 mL

Description

COX16 Polyclonal specifically detects COX16 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: COX16
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C14orf112, chromosome 14 open reading frame 112, COX16 cytochrome c oxidase assembly homolog (S. cerevisiae), cytochrome c oxidase assembly factor, cytochrome c oxidase assembly protein COX16 homolog, mitochondrial, HSPC203
• Gene Symbols: COX16
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q9P0S2
• Gene ID (Entrez): 51241
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKT
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only