missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COX15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35454-100ul
This item is not returnable.
View return policy
Description
COX15 Polyclonal antibody specifically detects COX15 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| COX15 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:100 | |
| COX15 (yeast) homolog, cytochrome c oxidase assembly protein, COX15 homolog, cytochrome c oxidase assembly protein (yeast), cytochrome c oxidase assembly protein COX15 homolog, cytochrome c oxidase subunit 15, EC 1.4.4.2, EC 3.1.3.5 | |
| A synthetic peptide corresponding to a sequence within amino acids 150-250 of human COX15 (NP_510870.1).,, Sequence:, YSHRMWGRLVGLVYILPAAYFWRKGWLSRGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPPHK | |
| 100 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 1355 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction