missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COX11 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92311-0.1ml
This item is not returnable.
View return policy
Description
COX11 Polyclonal antibody specifically detects COX11 in Mouse, Rat samples. It is validated for Western Blot
Specifications
| COX11 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| COX11 (yeast) homolog, cytochrome c oxidase assembly protein, COX11 cytochrome c oxidase assembly homolog (yeast), COX11 homolog, cytochrome c oxidase assembly protein, COX11P, cytochrome c oxidase assembly protein COX11, mitochondrial, cytochrome c oxidase subunit 11 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human COX11 (NP_004366.1). ENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYID | |
| 0.1 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 1353 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction