COX11 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92311-0.02ml

Product Code. 18656901

Description

COX11 Polyclonal antibody specifically detects COX11 in Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: COX11
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: COX11 (yeast) homolog, cytochrome c oxidase assembly protein, COX11 cytochrome c oxidase assembly homolog (yeast), COX11 homolog, cytochrome c oxidase assembly protein, COX11P, cytochrome c oxidase assembly protein COX11, mitochondrial, cytochrome c oxidase subunit 11
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human COX11 (NP_004366.1). ENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYID
• Quantity: 0.02 mL
• Research Discipline: Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 1353
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified