COX10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59554

Product Code. 18258452

Description

COX10 Polyclonal specifically detects COX10 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: COX10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: COX10 (yeast) homolog, cytochrome c oxidase assembly protein (heme A:farnesyltransferase), COX10 homolog, cytochrome c oxidase assembly protein, heme A:farnesyltransferase (yeast), cytochrome c oxidase assembly protein, cytochrome c oxidase subunit X, EC 2.5.1.-, heme A: farnesyltransferase, Heme O synthase, protoheme IX farnesyltransferase, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1352
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q12887
• Gene Symbols: COX10
• Immunogen: Synthetic peptides corresponding to COX10(COX10 homolog, cytochrome c oxidase assembly protein, heme A) The peptide sequence was selected from the middle region of COX10. Peptide sequence APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Canine: 93%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only