missing translation for 'onlineSavingsMsg'
Learn More

COX-1 Antibody, Novus Biologicals™

Product Code. 18519853 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18519853 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18519853 Supplier Novus Biologicals Supplier No. NBP162466

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

COX-1 Polyclonal antibody specifically detects COX-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen COX-1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate Unconjugated
Dilution Western Blot 1.0 μg/mL, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose
Gene Accession No. P23219
Gene Alias COX-1, COX1PGG/HS, COX3, Cyclooxygenase-1, EC 1.14.99.1, PCOX1, PGH synthase 1, PGHS1, PGHS-1PHS1, PHS 1, prostaglandin G/H synthase 1, prostaglandin G/H synthase and cyclooxygenase, Prostaglandin H2 synthase 1, Prostaglandin-endoperoxide synthase 1, prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase andcyclooxygenase), PTGHS
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PTGS1(prostaglandin-endoperoxide synthase 1) The peptide sequence was selected form the middle region of PTGS1. Peptide sequence GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE. The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Hypoxia, Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 5742
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.