COX-1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-05599-100ul

Product Code. 18605366

Description

COX-1 Polyclonal antibody specifically detects COX-1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: COX-1
• Classification: Polyclonal
• Dilution: Western Blot 1:100 - 1:500, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: COX-1, COX1PGG/HS, COX3, Cyclooxygenase-1, EC 1.14.99.1, PCOX1, PGH synthase 1, PGHS1, PGHS-1PHS1, PHS 1, prostaglandin G/H synthase 1, prostaglandin G/H synthase and cyclooxygenase, Prostaglandin H2 synthase 1, Prostaglandin-endoperoxide synthase 1, prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase andcyclooxygenase), PTGHS
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 415-514 of mouse COX-1 (NP_904330.1). AIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLIMIFMIWEAFASKREVMSVSYASTNLEWLHGCPPPYHTFEEPTYVKVK
• Quantity: 100 μg
• Research Discipline: Cancer, Hypoxia, Immunology, Innate Immunity
• Gene ID (Entrez): 5742
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified