missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cornulin Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92568-0.02ml
Denne vare kan ikke returneres.
Se returpolicy
Beskrivelse
Cornulin Polyclonal antibody specifically detects Cornulin in Human, Mouse samples. It is validated for Western Blot
Tekniske data
| Cornulin | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| 53 kDa squamous epithelial-induced stress protein, 58 kDa heat shock protein, chromosome 1 open reading frame 10, cornulin, DRC1, PDRC1,53 kDa putative calcium-binding protein, SEP53C1orf10, Squamous epithelial heat shock protein 53, Tumor-related protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 396-495 of human CRNN (NP_057274.1). GETVPGGQAQTGASTESGRQEWSSTHPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRGITARELYSYLRSTKP | |
| 0.02 mL | |
| Cancer, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 49860 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion