missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COQ7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | COQ7 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18204744
|
Novus Biologicals
NBP2-57950 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18626356
|
Novus Biologicals
NBP2-57950-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
COQ7 Polyclonal specifically detects COQ7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifikationer
| COQ7 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| CAT5, CLK1, CLK-1, Coenzyme Q biosynthesis protein 7 homolog, coenzyme Q, 7 (rat, yeast) homolog, coenzyme Q7 homolog, ubiquinone (yeast), COQ7 coenzyme Q, 7 homolog ubiquinone, placental protein KG-20, Timing protein clk-1 homolog, ubiquinone biosynthesis protein COQ7 homolog | |
| COQ7 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 10229 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel