COQ3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-88725

Product Code. 18234207

Description

COQ3 Polyclonal specifically detects COQ3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: COQ3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Alias: 3-demethylubiquinone-10 3-methyltransferase, bA9819.1, coenzyme Q3 homolog, methyltransferase (S. cerevisiae), coenzyme Q3 homolog, methyltransferase (yeast), DHHB methyltransferase, DHHBMT, DHHB-MT, DHHB-MTase, DHHBMTASE, Dihydroxyhexaprenylbenzoate methyltransferase, EC 2.1.1, EC 2.1.1.114, EC 2.1.1.64, hexaprenyldihydroxybenzoate methyltransferase, mitochondrial3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase, methyltransferase COQ3, UG0215E05
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: COQ3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPV
• Quantity: 0.1 mL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 51805
• Target Species: Human
• Isotype: IgG

For Research Use Only