missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18355129

COQ2 Antibody (2B4), Novus Biologicals™

Product Code. 18355129 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18355129 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18355129 Supplier Novus Biologicals Supplier No. H00027235M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

COQ2 Monoclonal antibody specifically detects COQ2 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen COQ2
Applications Western Blot, ELISA
Classification Monoclonal
Clone 2B4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_056512
Gene Alias 4-hydroxybenzoate polyprenyltransferase, coenzyme Q2 homolog, prenyltransferase (yeast), COQ2 homolog, EC 2.5.1, EC 2.5.1.39, FLJ13014, hCOQ2, mitochondrial, Para-hydroxybenzoate--polyprenyltransferase, para-hydroxybenzoate-polyprenyltransferase, mitochondrial, PHB:polyprenyltransferase
Host Species Mouse
Immunogen COQ2 (NP_056512.3, 84 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDK
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27235
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.