missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Copine-6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Copine-6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Copine-6 Polyclonal specifically detects Copine-6 in Mouse samples. It is validated for Western Blot.Specifications
| Copine-6 | |
| Polyclonal | |
| Rabbit | |
| NP_034077 | |
| 9362 | |
| The specific Immunogen is proprietary information. Peptide sequence YLQALRTVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Copine VI, copine VI (neuronal), copine-6, N-COPINE, neuronal copine, Neuronal-copine | |
| CPNE6 | |
| IgG | |
| 62 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title