IBA57 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55157-25ul

Product Code. 18657868

Description

IBA57 Polyclonal specifically detects IBA57 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: C1orf69
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: C1orf69, FLJ12734, FLJ13849, IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae), iron-sulfur cluster assembly factor for biotin synthase- and aconitase-like mitochondrial proteins, with a mass of 57kDa, mitochondrial, putative transferase C1orf69, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 200205
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: IBA57
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AGYAHFLNVQGRTLYDVILYGLQEHSEVSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVWAVLPSSPEACGAASLQERAGAAAILIRD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only