missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
COP9 signalosome complex subunit 2 Polyclonal antibody specifically detects COP9 signalosome complex subunit 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | COP9 signalosome complex subunit 2 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | ALIEN, Alien homolog, COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis), COP9 signalosome complex subunit 2, CSN2JAB1-containing signalosome subunit 2, SGN2TR-interacting protein 15, Signalosome subunit 2, thyroid receptor interacting protein 15, Thyroid receptor-interacting protein 15, TRIP15TRIP-15 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMT |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?