missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Connexin 43/GJA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38234-25ul
This item is not returnable.
View return policy
Description
Connexin 43/GJA1 Polyclonal specifically detects Connexin 43/GJA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Connexin 43/GJA1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| P17302 | |
| GJA1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR | |
| 25 μL | |
| Cancer, Cellular Markers, Core ESC Like Genes, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Markers | |
| 2697 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| connexin 43, connexin-43, Cx43, CX43gap junction protein, alpha-like, DFNB38, Gap junction 43 kDa heart protein, gap junction alpha-1 protein, gap junction protein, alpha 1, 43kDa, gap junction protein, alpha 1, 43kDa (connexin 43), GJAL, HSS, ODD, ODDD, ODOD, SDTY3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction