missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Connexin 37/GJA4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £359.00
Specifications
| Antigen | Connexin 37/GJA4 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18683500
|
Novus Biologicals
NBP2-92410-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18694631
|
Novus Biologicals
NBP2-92410-0.1ml |
0.1 mL |
£359.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Connexin 37/GJA4 Polyclonal antibody specifically detects Connexin 37/GJA4 in Human samples. It is validated for Western BlotSpecifications
| Connexin 37/GJA4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cardiovascular Biology, Cell Biology, Cytoskeleton Markers, Immunology, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 2701 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| connexin 37, Connexin-37, Cx37, CX37connexin-37, gap junction alpha-4 protein, gap junction protein, alpha 4, 37kD (connexin 37), gap junction protein, alpha 4, 37kDa, gap junction protein, alpha 4, 37kDa (connexin 37) | |
| A synthetic peptide corresponding to a sequence within amino acids 229-333 of human Connexin 37/GJA4 (NP_002051.2). VHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title