Connexin 26/GJB2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10835-100UL

Artikelnummer. 18385665

Beschreibung

Connexin 26/GJB2 Polyclonal specifically detects Connexin 26/GJB2 in Mouse samples. It is validated for Western Blot.

Spezifikation

• Antigen: Connexin 26/GJB2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: beta 2, 26kD (connexin 26), Cx26, CX26DFNA3, DFNA3A, DFNB1, gap junction protein, beta 2, 26kDa, gap junction protein, beta 2, 26kDa (connexin 26), NSRD1
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse Connexin 26/GJB2 (NP_032151.1). Peptide sequence DWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADF
• Quantity: 100 μg
• Research Discipline: Neuroscience, Sensory Systems
• Gene ID (Entrez): 2706
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified