missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Complexin-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£390.00
Specifications
| Antigen | Complexin-2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Complexin-2 Polyclonal specifically detects Complexin-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Complexin-2 | |
| Polyclonal | |
| Rabbit | |
| Q6PUV4 | |
| 10814 | |
| Synthetic peptides corresponding to CPLX2 (complexin 2) The peptide sequence was selected from the N terminal of CPLX2. Peptide sequence MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| complexin 2, Complexin II, complexin-2, CPX II, CPX2, CPX-2, DKFZp547D155, Hfb1, MGC138492, synaphin 1,921-L, synaphin-1 | |
| CPLX2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title