missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Complement Factor H Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £443.00
Specifications
| Antigen | Complement Factor H |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18466971
|
Novus Biologicals
NBP2-33933-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18102254
|
Novus Biologicals
NBP2-33933 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Complement Factor H Polyclonal specifically detects Complement Factor H in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Complement Factor H | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| adrenomedullin binding protein, age-related maculopathy susceptibility 1, AHUS1, AMBP1, ARMD4, beta-1H, beta-1-H-globulin, CFHL3, complement factor H, factor H, factor H-like 1, FH, FHL1, H factor 1, H factor 1 (complement), H factor 2 (complement), HF, HF1ARMS1, HF2, HUSMGC88246 | |
| CFH | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P08603 | |
| 3075 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title