missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Complement Factor B Antibody, Novus Biologicals™

Complement Factor B Antibody, Novus Biologicals™

Product Code. 18416435 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18416435 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18416435 Supplier Novus Biologicals Supplier No. NBP18998525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Complement Factor B Polyclonal antibody specifically detects Complement Factor B in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen).
TRUSTED_SUSTAINABILITY

Specifications

Antigen Complement Factor B
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.1 mg/mL
Conjugate Unconjugated
Dilution Simple Western 1:20, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunohistochemistry-Frozen
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias BF AHUS4, B-factor, properdin, BFD, C3 proaccelerator, C3 proactivator, C3/C5 convertase, complement factor B, EC 3.4.21, EC 3.4.21.47, FB, FBI12, GBGCFAB, Glycine-rich beta glycoprotein, glycine-rich beta-glycoprotein, H2-Bf, PBF2, Properdin factor B
Gene Symbols CFB
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 629
Test Specificity Specificity of human Complement Factor B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Rat, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.