missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Complement C3 Antibody (X1), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00000718-M11-100ug
This item is not returnable.
View return policy
Description
Complement C3 Monoclonal antibody specifically detects Complement C3 in Human samples. It is validated for Western Blot, ELISA
Specifications
| Complement C3 | |
| Monoclonal | |
| Unconjugated | |
| PBS (pH 7.4) | |
| Acylation Stimulating Protein, acylation-stimulating protein cleavage product, AHUS5, ARMD9, ASP, C3, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1, C3a, C3a anaphylatoxin, C3adesArg, C3b, C3bc, C3-beta-c, complement C3, Complement C3 alpha chain, Complement C3 beta chain, Complement C3b alpha' chain, Complement C3c alpha' chain fragment 1, Complement C3c alpha' chain fragment 2, Complement C3d fragment, Complement C3dg fragment, Complement C3f fragment, Complement C3g fragment, complement component 3, complement component C3, complement component C3a, complement component C3b, CPAMD1, EC 3.4.21.43, epididymis secretory sperm binding protein Li 62p, HEL-S-62p, prepro-C3 | |
| This Complement C3 Antibody (X1) was developed against C3 (NP_000055, 1534 a.a. ~ 1644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK | |
| 100 μg | |
| Angiogenesis, Apoptosis, Autoimmune Diseases, Immunology, Inflammation, Innate Immunity, Mesenchymal Stem Cell Markers, Neurodegeneration, Neuroscience, Signal Transduction | |
| 718 | |
| Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA | |
| X1 | |
| Western Blot, ELISA | |
| NP_000055 | |
| Mouse | |
| Protein A or G purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction