Collagen VI alpha 1 Antibody, Novus Biologicals™

Artikelnummer.	Quantity	unitSize
18490992	25 μL	25µL
18383721	0.1 mL	0.1mL

Artikelnummer. 18490992 Lieferant Novus Biologicals Lieferanten-Nr. NBP19119525ul

Beschreibung

Rabbit Polyclonal Antibody

Collagen VI alpha 1 Polyclonal specifically detects Collagen VI alpha 1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spezifikation

• Antigen: Collagen VI
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Collagen 6, collagen alpha-1(VI) chain, collagen VI, alpha-1 polypeptide, collagen, type VI, alpha 1, Collagen-6, human mRNA for collagen VI alpha-1 C-terminal globular domain10alpha 1 (VI) chain (61 AA), OPLL
• Gene Symbols: COL6A1
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VSVGIKDVFDFIPGSDQLNVISCQGLAPSQGRPGLSLVKENYAELLEDAFLKNVTAQICIDKKCPDYTCPITFSSPADITILLD
• Purification Method: Affinity Purified
• Quantity: 25 μL
• Regulatory Status: RUO
• Research Discipline: Cytoskeleton Markers, Extracellular Matrix
• Primary or Secondary: Primary
• Gene ID (Entrez): 1291
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only