missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen IV Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£145.00 - £383.00
Specifications
| Antigen | Collagen IV |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Dot Blot 1:500 - 1:1000 |
| Applications | ELISA, Western Blot, Dot Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30227393
|
Novus Biologicals
NBP3-33471-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227252
|
Novus Biologicals
NBP3-33471-100ul |
100 μL |
£383.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Collagen IV Monoclonal antibody specifically detects Collagen IV in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Dot BlotSpecifications
| Collagen IV | |
| ELISA, Western Blot, Dot Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers, Extracellular Matrix, Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 1282 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Dot Blot 1:500 - 1:1000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| BSVD;BSVD1;COL4A1s;Collagen alpha-1(IV) chain;PADMAL;RATOR | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1573-1690 of human Collagen IV (NP_000083.3).,, Sequence:, AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title