missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Collagen I alpha 1 Antibody - Azide and BSA Free, Novus Biologicals™

Collagen I alpha 1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

£186.00 - £385.00

Tekniske data

Antigen Collagen I alpha 1
Dilution Western Blot 1:1000 - 1:5000, Immunohistochemistry 1:2000 - 1:10000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Se flere specifikationer

Produkter 2
Produktkode Brand Quantity Pris Mængde & tilgængelighed  
Produktkode Brand Quantity Pris Mængde & tilgængelighed  
18617282
missing translation for 'viewDocuments'
missing translation for 'viewProductCertificates'
Novus Biologicals
NBP2-92877-0.02ml 		0.02 mL
£186.00
0.02mL
Se alternative produkter
missing translation for 'toSaveUpto'  »
Please to purchase this item. Need a web account? Register with us today!
18686902
missing translation for 'viewDocuments'
missing translation for 'viewProductCertificates'
Novus Biologicals
NBP2-92877-0.1ml 		0.1 mL
£385.00
0.10mL
Se alternative produkter
missing translation for 'toSaveUpto'  »
Please to purchase this item. Need a web account? Register with us today!
Beskrivelse

Beskrivelse

Collagen I alpha 1 Polyclonal antibody specifically detects Collagen I alpha 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Tekniske data

Tekniske data

Collagen I alpha 1
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
Cell Biology, Cellular Markers, Extracellular Matrix, Signal Transduction, Stem Cells
PBS with 50% glycerol, pH7.3.
1277
IgG
Affinity purified
Western Blot 1:1000 - 1:5000, Immunohistochemistry 1:2000 - 1:10000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
Polyclonal
Purified
RUO
Human, Mouse, Rat
Alpha-1 type I collagen, COL-IA1, Collagen 1, Collagen 1 alpha 1, collagen alpha 1 chain type I, collagen alpha-1(I) chain, collagen of skin, tendon and bone, alpha-1 chain, Collagen Type I Alpha 1 Chain, collagen, type I, alpha 1, Collagen1, Collagen-1, EDSARTH1, OI4, pro-alpha-1 collagen type 1, Type I Procollagen Alpha 1 Chain
A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human Collagen I alpha 1 (NP_000079.2). GEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF
Primary
Store at -20°C. Avoid freeze-thaw cycles.
Videoer
SDS
Dokumenter

Dokumenter

Certifikater
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.