missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COL9A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | COL9A1 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18654649
|
Novus Biologicals
NBP2-68987-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18640437
|
Novus Biologicals
NBP2-68987 |
100 μg |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descrizione
COL9A1 Polyclonal antibody specifically detects COL9A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifica
| COL9A1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 1297 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| alpha-1 polypeptide, collagen, type IX, alpha 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto