missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COL8A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | COL8A2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
COL8A2 Polyclonal specifically detects COL8A2 in Human samples. It is validated for Western Blot.Specifications
| COL8A2 | |
| Polyclonal | |
| Rabbit | |
| NP_005193 | |
| 1296 | |
| Synthetic peptide directed towards the middle region of human COL8A2The immunogen for this antibody is COL8A2. Peptide sequence AAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| alpha-2 polypeptide, collagen, type VIII, alpha 2, dJ665N4.1 (collagen type VIII alpha 2), FECD, FLJ00201, MGC116970, PPCD, PPCD2MGC116972 | |
| COL8A2 | |
| IgG | |
| 67 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title