missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COL24A1 Antibody (1D8), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00255631-M07
This item is not returnable.
View return policy
Description
COL24A1 Monoclonal antibody specifically detects COL24A1 in Human samples. It is validated for Western Blot, ELISA
Specifications
| COL24A1 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| collagen alpha-1(XXIV) chain, collagen, type XXIV, alpha 1, MGC142214 | |
| COL24A1 (NP_690850, 1626 a.a. ∽ 1714 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKATFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA | |
| 1D8 | |
| Western Blot 1:500, ELISA | |
| NP_690850 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 255631 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction