missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COG4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | COG4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
COG4 Polyclonal specifically detects COG4 in Human samples. It is validated for Western Blot.Specifications
| COG4 | |
| Polyclonal | |
| Rabbit | |
| Golgi Apparatus Markers | |
| CDG2J, COD1complexed with Dor1p, COG complex subunit 4, component of oligomeric golgi complex 4DKFZp586E1519, conserved oligomeric Golgi complex protein 4, conserved oligomeric Golgi complex subunit 4, DKFZP586E1519 | |
| COG4 | |
| IgG | |
| This product is specific to Subunit or Isoform: 4. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9H9E3 | |
| 25839 | |
| Synthetic peptides corresponding to COG4(component of oligomeric golgi complex 4) The peptide sequence was selected from the middle region of COG4. Peptide sequence TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR. | |
| Primary | |
| 89 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title