Learn More
Invitrogen™ Cofilin 2 Polyclonal Antibody
Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA579037
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Raji whole cell lysates, human HUVEC whole cell lysates, human HepG2 whole cell lysates, human Hela whole cell lysates, rat skeletal muscle tissue lysates, rat RH35 whole cell lysates, rat liver tissue lysates, mouse skeletal muscle tissue lysates, mouse liver tissue lysates. ICC/IF: U2OS cells. Flow: Raji cells.
Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
Specifications
| Cofilin 2 | |
| Polyclonal | |
| Unconjugated | |
| CFL2 | |
| CFL2; COF2; cofilin 2; cofilin 2 (muscle); cofilin 2, muscle; cofilin, muscle isoform; Cofilin-2; HGNC:1875; NEM7; nemaline myopathy type 7 | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 1073, 12632, 366624 | |
| -20°C | |
| Lyophilized |
| Flow Cytometry, Western Blot, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot | |
| 500 μg/mL | |
| PBS with 4mg trehalose and no preservative | |
| P45591, Q9Y281 | |
| CFL2 | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.