missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Coagulation Factor III/Tissue Factor Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £409.00
Specifications
| Antigen | Coagulation Factor III/Tissue Factor |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18273352
|
Novus Biologicals
NBP2-55950 |
100 μL |
£409.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18648326
|
Novus Biologicals
NBP2-55950-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Coagulation Factor III/Tissue Factor Polyclonal specifically detects Coagulation Factor III/Tissue Factor in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Coagulation Factor III/Tissue Factor | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2152 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), FLJ17960, TF, TFA, Thromboplastin, tissue factor | |
| F3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title