Coagulation Factor II/Thrombin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18450622	Novus Biologicals NBP2-33728-25ul	25 μL
18162505	Novus Biologicals NBP2-33728	0.1 mL

Description

Coagulation Factor II/Thrombin Polyclonal specifically detects Coagulation Factor II/Thrombin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Coagulation Factor II/Thrombin
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Coagulation Factor II, coagulation factor II (thrombin) receptor-like 2, Coagulation factor II receptor-like 2, Coagulation factor II receptor-like 2 (protease-actovated receptor 3), PAR-3, PAR3proteinase-activated receptor 3, protease-activated receptor 3, proteinase-activated receptor-3, PT, serine protease, Thrombin receptor-like 2
• Gene Symbols: F2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: P00734
• Gene ID (Entrez): 2147
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only