missing translation for 'onlineSavingsMsg'
Learn More

CNPase Antibody (CL2872), Novus Biologicals™

Mouse Monoclonal Antibody

£292.00 - £410.00

Specifications

Antigen	CNPase
Clone	CL2872
Dilution	Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Monoclonal

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18603406 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-46636-25ul	25 μL	£292.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18676775 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-46636	0.1 mL	£410.00 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

CNPase Monoclonal antibody specifically detects CNPase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	CNPase
Dilution	Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Accession No.	P09543
Gene ID (Entrez)	1267
Isotype	IgG1
Purification Method	Protein A purified

Clone	CL2872
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Mouse
Research Discipline	Cellular Markers, Glia Markers, Neuronal Cell Markers, Neuroscience, Oligodendrocyte Cell Markers
Formulation	PBS (pH 7.2), 40% Glycerol
Gene Alias	2', 3' cyclic nucleotide 3' phosphohydrolase, 2'-3'-cyclic nucleotide 3' phosphodiesterase, 2'-3'-cyclic-nucleotide 3'-phosphodiesterase, CNP1, CNPase, EC 3.1.4.37
Immunogen	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITL
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

CNPase Antibody (CL2872), Novus Biologicals™

Specifications

Description

Specifications

Documents