CNOX Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92146-0.02ml

Product Code. 18647051

Description

CNOX Polyclonal antibody specifically detects CNOX in Human, Mouse samples. It is validated for Western Blot

Specifications

• Antigen: CNOX
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: candidate growth-related and time keeping constitutive hydroquinone (NADH)oxidase, Candidate growth-related and time keeping constitutive hydroquinone [NADH]oxidase, cCNOXConstitutive Ecto-NOX, Cell proliferation-inducing gene 38 protein, cNOX, CNOXbA64J21.1, ecto-NOX disulfide-thiol exchanger 1, FLJ10094, PIG38, proliferation-inducing protein 38
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 450-560 of human ENOX1 (NP_060463.2). LKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ
• Quantity: 0.02 mL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55068
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG