CNBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55690

Product Code. 18202351

Description

CNBP Polyclonal specifically detects CNBP in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CNBP
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CCHC-type zinc finger, nucleic acid binding protein, cellular nucleic acid binding protein, cellular nucleic acid-binding protein, DM2, erythroid differentiation-related, FLJ11631, PROMM, RNF163CNBP1ZNF9ZCCHC22, sterol regulatory element-binding protein, zinc finger protein 273, Zinc finger protein 9, zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CNBP
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 7555
• Target Species: Human
• Isotype: IgG

For Research Use Only