CNAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35835-20ul

Product Code. 30229135

Description

CNAP1 Polyclonal antibody specifically detects CNAP1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: CNAP1
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: CAPD2, CAP-D2, Chromosome condensation-related SMC-associated protein 1, Chromosome-associated protein D2, CNAP1XCAP-D2 homolog, hCAP-D2condensin complex subunit 1, KIAA0159chromosome condensation related SMC associated protein 1, Non-SMC condensin I complex subunit D2, non-SMC condensin I complex, subunit D2
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1250-1350 of human CNAP1 (NP_055680.3).,, Sequence:, FGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPLASTASDNDFVTPEPRRTTRRHP
• Quantity: 20 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Mitotic Regulators, Stem Cell Markers
• Gene ID (Entrez): 9918
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified