missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CMTM6 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33341-20ul
This item is not returnable.
View return policy
Description
CMTM6 Monoclonal antibody specifically detects CMTM6 in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| CMTM6 | |
| Monoclonal | |
| Western Blot 1:2000 - 1:10000, ELISA Recommended starting concentration is 1 μg/mL, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| chemokine-like factor super family 6, chemokine-like factor superfamily 6, Chemokine-like factor superfamily member 6, CKLF-like MARVEL transmembrane domain containing 6, CKLF-like MARVEL transmembrane domain-containing protein 6, CKLFSF6, FLJ20396, PRO2219 | |
| A synthetic peptide corresponding to a sequence within amino acids 84-183 of human CMTM6 (NP_060271.1).,, Sequence:, LILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA | |
| 20 μL | |
| Cytokine Research | |
| 54918 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction