missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CMSS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £484.00
Specifications
| Antigen | C3orf26 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18490671
|
Novus Biologicals
NBP1-81078-25ul |
25ul |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18208605
|
Novus Biologicals
NBP1-81078 |
0.1 mL |
£484.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CMSS1 Polyclonal specifically detects CMSS1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| C3orf26 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 84319 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:DEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C3orf26, chromosome 3 open reading frame 26, cms1 ribosomal small subunit homolog (yeast), hypothetical protein LOC84319, MGC4308 | |
| CMSS1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human CMSS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title