missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18371572

CMIP2 Antibody, Novus Biologicals™

Product Code. 18371572 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 uL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18371572 100 uL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18371572 Supplier Novus Biologicals Supplier No. NBP306878

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CMIP2 Polyclonal antibody specifically detects CMIP2 in Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen CMIP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 μg/mL
Formulation PBS, 2% sucrose
Gene Alias Cell Migration Inducing Hyaluronidase 2, Cell Surface Hyaluronidase, EC 3.2.1.35, KIAA1412, TMEM2, transmembrane protein 2
Host Species Rabbit
Immunogen This CMIP2 Antibody - N-terminal was developed against a synthetic peptide located within the following region: MYAAGSRGHSPAFLQPQNGNGHRSPGYVPGKVVPLRPAPPPKNHASAKLT
Purification Method Affinity purified
Quantity 100 uL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23670
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.