missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CLN8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CLN8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CLN8 Polyclonal specifically detects CLN8 in Human samples. It is validated for Western Blot.Specifications
| CLN8 | |
| Polyclonal | |
| Rabbit | |
| NP_061764 | |
| 2055 | |
| Synthetic peptide directed towards the N terminal of human CLN8. Peptide sequence VFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVAV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C8orf61, ceroid-lipofuscinosis, neuronal 8 (epilepsy, progressive with mental retardation), EPMR | |
| CLN8 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title