missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CLIC4 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33286-100ul
This item is not returnable.
View return policy
Description
CLIC4 Monoclonal antibody specifically detects CLIC4 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| CLIC4 | |
| Monoclonal | |
| Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL | |
| chloride intracellular channel 4, chloride intracellular channel 4 like, chloride intracellular channel protein 4, CLIC4L, DKFZp566G223, FLJ38640, H1, huH1, Intracellular chloride ion channel protein p64H1, MTCLIC, p64H1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CLIC4 (NP_039234.1).,, Sequence:, MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLC | |
| 100 μL | |
| Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Endocrinology, Signal Transduction | |
| 25932 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction