CLIC4 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33286-20ul

Product Code. 30228236

Description

CLIC4 Monoclonal antibody specifically detects CLIC4 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: CLIC4
• Classification: Monoclonal
• Dilution: Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: chloride intracellular channel 4, chloride intracellular channel 4 like, chloride intracellular channel protein 4, CLIC4L, DKFZp566G223, FLJ38640, H1, huH1, Intracellular chloride ion channel protein p64H1, MTCLIC, p64H1
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CLIC4 (NP_039234.1).,, Sequence:, MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLC
• Quantity: 20 μL
• Research Discipline: Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Endocrinology, Signal Transduction
• Gene ID (Entrez): 25932
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified