missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CLECL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | CLECL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CLECL1 Polyclonal specifically detects CLECL1 in Human samples. It is validated for Western Blot.Specifications
| CLECL1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C-type lectin-like 1, C-type lectin-like domain family 1, DCAL-1, DCAL1dendritic cell associated lectin 1, DC-associated lectin-1, Dendritic cell-associated lectin 1, dendritic cell-associated lectin-1, type II transmembrane protein DCAL1 | |
| CLECL1 | |
| IgG | |
| 19 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IZS7 | |
| 160365 | |
| Synthetic peptides corresponding to CLECL1(C-type lectin-like 1) The peptide sequence was selected from the middle region of CLECL1. Peptide sequence FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title