missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CLEC16A Antibody, R&D Systems™

CLEC16A Antibody, R&D Systems™

Artikelnummer. 18620339 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Quantity:
25 μL
100 μL
Pakningsstørrelse:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity Pakningsstørrelse
18620339 25 μL 25µL
18286374 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18620339 Leverandør Novus Biologicals Leverandørnr. NBP25715025ul
 Restricted Item
Estimated Shipment: 02-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

CLEC16A Polyclonal specifically detects CLEC16A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen CLEC16A
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias C-type lectin domain family 16, member A, KIAA0350Gop-1, MGC111457, protein CLEC16A
Gene Symbols CLEC16A
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPETQLPLTREEDLIKTDDVLDLNNSDLIACTVITKDGGMVQRFLAVDIYQMSLVEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRALNITIHKP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 23274
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.