CLEC14A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56335-25ul

Product Code. 18635187

Description

CLEC14A Polyclonal specifically detects CLEC14A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CLEC14A
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C14orf27, CEG1, chromosome 14 open reading frame 27, ClECT and EGF-like domain containing protein, C-type lectin domain family 14 member A, C-type lectin domain family 14, member A, EGFR5, EGFR-5, Epidermal growth factor receptor 5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 161198
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CLEC14A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RCAVLQATGGVEPAGWKEMRCHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGTEVS
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only