missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CLDND1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CLDND1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CLDND1 Polyclonal specifically detects CLDND1 in Human samples. It is validated for Western Blot.Specifications
| CLDND1 | |
| Polyclonal | |
| Rabbit | |
| Q9NY35 | |
| 56650 | |
| Synthetic peptides corresponding to CLDND1(claudin domain containing 1) The peptide sequence was selected from the middle region of CLDND1. Peptide sequence TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C3orf4, chromosome 3 open reading frame 4, claudin domain containing 1, claudin domain containing 1 protein, claudin domain-containing protein 1, GENX-3745, Membrane protein GENX-3745, MGC111162, MGC3316, MGC9861 | |
| CLDND1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title