missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CLCA4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Description
CLCA4 Polyclonal antibody specifically detects CLCA4 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | CLCA4 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | caCC-2, CaCC2CaCC, Calcium-activated chloride channel family member 4, Calcium-activated chloride channel protein 2, calcium-activated chloride channel regulator 4, chloride channel accessory 4, chloride channel regulator 4, chloride channel, calcium activated, family member 4, hCaCC-2, hCLCA4, MGC142247, MGC142249 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NEDQPFYRAKSKKIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQT |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?