missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Claudin-5 Monoclonal antibody specifically detects Claudin-5 in Human samples. It is validated for ELISA, ELISA
Specifications
Specifications
| Antigen | Claudin-5 |
| Applications | ELISA, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 3D8 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_003268 |
| Gene Alias | AWALTransmembrane protein deleted in VCFS, BEC1, claudin 5, claudin-5, CPETRL1, TMVCFTMDVCF, transmembrane protein deleted in velocardiofacial syndrome |
| Host Species | Mouse |
| Immunogen | CLDN5 (NP_003268, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?