missing translation for 'onlineSavingsMsg'
Learn More

Claudin-5 Antibody (3D8), Novus Biologicals™

Product Code. 18389747 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18389747 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18389747 Supplier Novus Biologicals Supplier No. H00007122M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Claudin-5 Monoclonal antibody specifically detects Claudin-5 in Human samples. It is validated for ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Claudin-5
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 3D8
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003268
Gene Alias AWALTransmembrane protein deleted in VCFS, BEC1, claudin 5, claudin-5, CPETRL1, TMVCFTMDVCF, transmembrane protein deleted in velocardiofacial syndrome
Host Species Mouse
Immunogen CLDN5 (NP_003268, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cellular Markers
Primary or Secondary Primary
Gene ID (Entrez) 7122
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.