Claudin-3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10555-100UL

Product Code. 18335565

Description

Claudin-3 Polyclonal specifically detects Claudin-3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Claudin-3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C7orf1, claudin 3, claudin-3, Clostridium perfringens enterotoxin receptor 2, CPE-R 2, CPE-R2, CPETR2CPE-receptor 2, HRVP1, Rat ventral prostate.1 protein homolog, RVP1, ventral prostate.1 protein homolog, ventral prostate.1-like protein
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_034032). Peptide sequence VPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPRDKYAPTKILYSAP
• Quantity: 100 μg
• Research Discipline: Cell Biology, Cellular Markers, Extracellular Matrix
• Gene ID (Entrez): 1365
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified