missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Claudin-16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | Claudin-16 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
Claudin-16 Polyclonal specifically detects Claudin-16 in Human, Mouse samples. It is validated for Western Blot.Specifications
| Claudin-16 | |
| Polyclonal | |
| Purified | |
| RUO | |
| claudin 16, claudin-16, HOMG3paracellin-1, Paracellin-1, PCLN-1, PCLN1hypomagnesemia 3, with hypercalciuria and nephrocalcinosis | |
| CLDN16 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q9Y5I7 | |
| 10686 | |
| Synthetic peptides corresponding to CLDN16 (claudin 16) The peptide sequence was selected from the C terminal of CLDN16. Peptide sequence FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title